HPA007354

MFAP2 antibody from Sigma-Aldrich
MAGP, MAGP-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007354
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007354, RRID:AB_1079365
Product name
Anti-MFAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007354
Antibody type
Polyclonal
Antigen
Microfibrillar-associated protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQ
QVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYP
CTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICV
RTVCAHEELLRADLCRDKFSKCG
Storage
-20C
Provider Type Product Number
- No reagents -