ABIN630366

antibody from antibodies-online

Targeting: SLC16A8 MCT3, REMP

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630366 - Provider product page
Provider: antibodies-online
Product name: anti-Monocarboxylate Transporter 3 (MCT3) antibody
Antibody type: Polyclonal
Antigen: SLC16 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

SLC16A8 protein structure - ABIN630366 shown in red.