HPA027537

SLCO1A2 antibody from Sigma-Aldrich
OATP, OATP-A, OATP1A2, SLC21A3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027537
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027537, RRID:AB_10603240
Product name
Anti-SLCO1A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027537
Antibody type
Polyclonal
Antigen
solute carrier organic anion transporter family, member 1A2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPS
KIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQ
NCSCIQTSGNSSAVLGLCDKGPDC
Storage
-20C
Provider Type Product Number
- No reagents -