Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28677 - Provider product page
- Provider
- Abnova Corporation
- Product name
- NCAPH polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant NCAPH, subunit H.
- Antigen sequence
LHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEM
TDLKAPLQQCAEDRQICPSLAGFQFTQWDSETHNE
SVSALVDKFKKNDQVFDINAEVDESDCGDFPDGSL
GDDFDANDEPDHT- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot anyalysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with NCAPH polyclonal antibody (Cat # PAB28677).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with NCAPH polyclonal antibody (Cat # PAB28677) at 1-4 ug/mL shows positivity in cytoplasm & cytoskeleton (microtubules).
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil with NCAPH polyclonal antibody (Cat # PAB28677) shows cytoplasmic positivity in reaction center cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry