HPA002647

NCAPH antibody from Atlas Antibodies
BRRN1, CAP-H, hCAP-H
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002647
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002647, RRID:AB_1078300
Product name
Anti-NCAPH
Provider product page
Atlas Antibodies - HPA002647
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEM
TDLKAPLQQCAEDRQICPSLAGFQFTQWDSETHNE
SVSALVDKFKKNDQVFDINAEVDESDCGDFPDGSL
GDDFDANDEPDHT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -