HPA003008

NCAPH antibody from Sigma-Aldrich
BRRN1, CAP-H, hCAP-H
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003008
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003008, RRID:AB_1078301
Product name
Anti-NCAPH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003008
Antibody type
Polyclonal
Antigen
Condensin complex subunit 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KFTNTQITEHYSTCIKLSTENKITTKNAFGLHLID
FMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVD
AVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEM
GTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCE
I
Storage
-20C
Provider Type Product Number
- No reagents -