HPA077993

KCNAB3 antibody from Atlas Antibodies
AKR6A9, KCNA3B

Antibody data

Product number
HPA077993
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA077993, RRID:AB_2686872
Product name
Anti-KCNAB3
Provider product page
Atlas Antibodies - HPA077993
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDG
KKQQAKVMDLLPVAHQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -