H00009196-B01P

KCNAB3 antibody from Abnova Corporation
AKR6A9, KCNA3B
No application information provided.

Antibody data

Product number
H00009196-B01P
Provider
Abnova Corporation
Product name
KCNAB3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00009196-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human KCNAB3 protein.
Antigen sequence
MQVSIACTEQNLRSRSSEDRLCGPRPGPGGGNGGP
AGGGHGNPPGGGGSGPKARAALVPRPPAPAGALRE
STGRGTGMKYRNLGKSGLRVSCLGLGTWVTFGSQI
SDETAEDVLTVAYEHGVNLFDTAEVYAAGKAERTL
GNILKSKGWRRSSYVITTKIFWGGQAETERGLSRK
HIIEGLRGSLERLQLGYVDIVFANRSDPNCPMEEI
VRAMTYVINQGLALYWGTSRWGAAEIMEAYSMARQ
FNLIPPVCEQAEHHLFQREKVEMQLPELYHKIGVG
SVTWYPLACGLITSKYDGRVPDTCRASIKGYQWLK
DKVQSEDGKKQQAKVMDLLPVAHQLGCTVAQLAIA
WCLRSEGVSSVLLGVSSAEQLIEHLGALQVLSQLT
PQTVMEIDGLLGNKPHSKK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -