Antibody data

Product number
ABIN183137
Provider
antibodies-online
Product name
anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 3 (KCNAB3) (N-Term) antibody
Provider product page
antibodies-online - ABIN183137
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNAB3 antibody: synthetic peptide directed towards the N terminal of human KCNAB3
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLT
VAYEH GVNLFDTAEV
Epitope
N-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -