AV35151

KCNAB3 antibody from Sigma-Aldrich
AKR6A9, KCNA3B
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV35151
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV35151, RRID:AB_1852108
Product name
Anti-KCNAB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV35151
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human KCNAB3 with an internal ID of P06381
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
TGRGTGMKYRNLGKSGLRVSCLGLGTWVTFGSQIS
DETAEDVLTVAYEHG
Storage
-20C
Provider Type Product Number
- No reagents -