HPA002813

DSN1 antibody from Atlas Antibodies
C20orf172, dJ469A13.2, hKNL-3, KNL3, MIS13
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002813
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002813, RRID:AB_1078343
Product name
Anti-DSN1
Provider product page
Atlas Antibodies - HPA002813
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTE
AKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQNQ
SKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKV
SVQLGKRSMQQLDPSPARKLLKLQLQNPPA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -