HPA002813

DSN1 antibody from Sigma-Aldrich
C20orf172, dJ469A13.2, hKNL-3, KNL3, MIS13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002813
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002813, RRID:AB_1078343
Product name
Anti-DSN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002813
Antibody type
Polyclonal
Antigen
Kinetochore-associated protein DSN1 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTE
AKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQNQ
SKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKV
SVQLGKRSMQQLDPSPARKLLKLQLQNPPA
Storage
-20C
Provider Type Product Number
- No reagents -