HPA023325

CNTROB antibody from Sigma-Aldrich
LIP8, PP1221
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023325
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023325, RRID:AB_1852892
Product name
Anti-CNTROB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023325
Antibody type
Polyclonal
Antigen
Centrobin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VHKTKVPLAMASSLFRVPEPPSSHSQGSGPSSGSP
ERGGDGLTFPRQLMEVSQLLRLYQARGWGALPAED
LLLYLKRLEHSGRTDGRGDNVPRRNTDSRL
Storage
-20C
Provider Type Product Number
- No reagents -