H00079077-B01

DCTPP1 antibody from Abnova Corporation
CDA03, MGC5627, RS21C6, XTP3TPA

Antibody data

Product number
H00079077-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079077-B01, RRID:AB_1581966
Product name
XTP3TPA MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00079077-B01
Antibody type
Polyclonal
Antigen
XTP3TPA (NP_077001.1, 1 a.a. ~ 170 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIR
RLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL
FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVA
LAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK
YTELPHGAISEDQAVGPADIPCDSTGQTST
Vial size
50 uL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -