HPA002832

DCTPP1 antibody from Sigma-Aldrich
CDA03, MGC5627, RS21C6, XTP3TPA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002832
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002832, RRID:AB_1080615
Product name
Anti-DCTPP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002832
Antibody type
Polyclonal
Antigen
XTP3-transactivated protein A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL
FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVA
LAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK
YTELPHGAISEDQAVGPADIPCDS
Storage
-20C
Provider Type Product Number
- No reagents -