HPA026777

VIPR1 antibody from Sigma-Aldrich
HVR1, RDC1, VPAC1, VPAC1R
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026777
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026777, RRID:AB_10604003
Product name
Anti-VIPR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026777
Antibody type
Polyclonal
Antigen
vasoactive intestinal peptide receptor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDN
LTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRS
CTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFY
GSVKTGY
Storage
-20C
Provider Type Product Number
- No reagents -