HPA024076

TMEM184B antibody from Sigma-Aldrich
C22orf5, DKFZP586A1024, FM08, HS5O6A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024076
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024076, RRID:AB_1858106
Product name
Anti-TMEM184B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024076
Antibody type
Polyclonal
Antigen
Transmembrane protein 184B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWR
GGAHGLSRSHSLSGARDNEKTLLLSSDDEF
Storage
-20C
Provider Type Product Number
- No reagents -