HPA003888

RNF122 antibody from Sigma-Aldrich
FLJ12526
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003888
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003888, RRID:AB_1079822
Product name
Anti-RNF122 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003888
Antibody type
Polyclonal
Antigen
RING finger protein 122 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLED
FKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCN
KPIASPSEATQNIGILLDEL
Storage
-20C
Provider Type Product Number
- No reagents -