Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003398-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003398-M04, RRID:AB_875642
- Product name
- ID2 monoclonal antibody (M04), clone 2C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ID2.
- Antigen sequence
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSL
LYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVID
YILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTT
LNTDISILSLQASEFPSELMSNDSKALCG- Isotype
- IgG
- Antibody clone number
- 2C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The transcriptional repressor ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression.
Ward SM, Fernando SJ, Hou TY, Duffield GE
The Journal of biological chemistry 2010 Dec 10;285(50):38987-9000
The Journal of biological chemistry 2010 Dec 10;285(50):38987-9000
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ID2 monoclonal antibody (M04), clone 2C11 Western Blot analysis of ID2 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ID2 expression in transfected 293T cell line by ID2 monoclonal antibody (M04), clone 2C11.Lane 1: ID2 transfected lysate(14.9 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ID2 monoclonal antibody (M04), clone 2C11. Western Blot analysis of ID2 expression in HepG2 ( Cat # L019V1 ).