HPA019850

APBA1 antibody from Sigma-Aldrich
D9S411E, MINT1, X11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019850
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019850, RRID:AB_1844906
Product name
Anti-APBA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019850
Antibody type
Polyclonal
Antigen
Amyloid beta A4 precursor protein-binding family A member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQ
DISPTRDCDDQRPMDGDSPSPGSSSPLGAESSSTS
LHPSDPVEASTNKESRKSLASFPTYVEVPGP
Storage
-20C
Provider Type Product Number
- No reagents -