H00004820-B01P

NKTR antibody from Abnova Corporation
p104
No application information provided.

Antibody data

Product number
H00004820-B01P
Provider
Abnova Corporation
Product name
NKTR purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00004820-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NKTR protein.
Antigen sequence
MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKT
CKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKN
FMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDR
AFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVF
GLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV
LATKSIKDVFEKKRKKPTHSEGSDSSSNSSSSSES
SSESELEHERSRRRKHKRRPKVKRSKKRRKEASSS
EEPRNKHAMNPKGHSERSDTNEKRSVDSSAKREKP
VVRPEEIPPVPENRFLLRRDMPVVTAEPEPKIPDV
APIVSDQKPSVSKSGRKIKGRGTIRYHTPPRSRSC
SESDDDDSSETPPHWKEEMQRLRAYRPPSGEKWSK
GDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDLST
ARHSGHHKKRRKEKKVKHKKKGKKQKHCRRHKQTK
KRRILIPSDIESSKSSTRRMKSSCDRERSSRSSSL
SSHHSSKRDWSKSDKDVQSSLTHSSRDSYRSKSHS
QSYSRGSSRSRTASKSSSHSRSRSKSRSSSKSGHR
KRASKSPRKTASQLSENKPVKTEPLRATMAQNENV
VVQPVVAENIPVIPLSDSPPPSRWKPGQKPWKPSY
ERIQEMKAKTTHLLPIQSTYSLANIKETGSSSSYH
KREKNSESDQSTYSKYSDRSSESSPRSRSRSSRSR
SYSRSYTRSRSLASSHSRSRSPSSRSHSRNKYSDH
SQCSRSSSYTSISSDDGRRAKRRLRSSGKKNSVSH
KKHSSSSEKTLHSKYVKGRDRSSCVRKYSESRSSL
DYSSDSEQSSVQATQSAQEKEKQGQMERTHNKQEK
NRGEEKSKSERECPHSKKRTLKENLSDHLRNGSKP
KRKNYAGSKWDSESNSERDVTKNSKNDSHPSSDKE
EGEATSDSESEVSEIHIKVKPTTKSSTNTSLPDDN
GAWKSSKQRTSTSDSEGSCSNSENNRGKPQKHKHG
SKENLKREHTKKVKEKLKGKKDKKHKAPKRKQAFH
WQPPLEFGEEEEEEIDDKQVTQESKEKKVSENNET
IKDNILKTEKSSEEDLSGKHDTVTVSSDLDQFTKD
DSKLSISPTALNTEENVACLQNIQHVEESVPNGVE
DVLQTDDNMEICTPDRSSPAKVEETSPLGNARLDT
PDINIVLKQDMATEHPQAEVVKQESSMSESKVLGE
VGKQDSSSASLASAGESTGKKEVAEKSQINLIDKK
WKPLQGVGNLAAPNAATSSAVEVKVLTTVPEMKPQ
GLRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQE
SSSDEQTPSRDDDSQSRSPSRSRSKSETKSRHRTR
SVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRG
RTRSRSSSYRSYKSHRTSSRSRSRSSSYDPHSRSR
SYTYDSYYSRSRSRSRSQRSDSYHRGRSYNRRSRS
CRSYGSDSESDRSYSHHRSPSESSRYS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -