HPA022120

NKTR antibody from Sigma-Aldrich
p104
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022120
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022120, RRID:AB_1854513
Product name
Anti-NKTR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022120
Antibody type
Polyclonal
Antigen
NK-tumor recognition protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSEEDLSGKHDTVTVSSDLDQFTKDDSKLSISPTA
LNTEENVACLQNIQHVEESVPNGVEDVLQTDDNME
ICTPDRSSPAKVEETSPLGNARLDTPDINIVLKQD
MAT
Storage
-20C
Provider Type Product Number
- No reagents -