HPA002884

FBXO40 antibody from Sigma-Aldrich
Fbx40, KIAA1195
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002884
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002884, RRID:AB_1078833
Product name
Anti-FBXO40 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002884
Antibody type
Polyclonal
Antigen
F-box only protein 40 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PNVDSETTLHENIMKETPSEECLDTALALQDQKVL
FRSLKMVELFPETREATEEEPTMNGETSVEEMGGA
VGGVDIGLVPHGLSATNGEMAELSQEEREVLAKTK
EGMDLVKFGQWENIFSKEHAASALTNSSASCESKN
KNDSEKE
Storage
-20C
Provider Type Product Number
- No reagents -