HPA022249

MAMDC2 antibody from Sigma-Aldrich
MGC21981
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022249
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022249, RRID:AB_2139157
Product name
Anti-MAMDC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022249
Antibody type
Polyclonal
Antigen
MAM domain-containing protein 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FSPVHCQNQTELLFSAVEASCNFEQDLCNFYQDKE
GPGWTRVKVKPNMYRAGDHTTGLGYYLLANTKFTS
QPGYIGRLYGPSLPGNLQYCLRFHYAIY
Storage
-20C
Provider Type Product Number
- No reagents -