Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310247 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the C terminal of human ALOX15B
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRP
LGTYP DEHFTEEAPR- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Inverse relationship between 15-lipoxygenase-2 and PPAR-gamma gene expression in normal epithelia compared with tumor epithelia.
Subbarayan V, Xu XC, Kim J, Yang P, Hoque A, Sabichi AL, Llansa N, Mendoza G, Logothetis CJ, Newman RA, Lippman SM, Menter DG
Neoplasia (New York, N.Y.) 2005 Mar;7(3):280-93
Neoplasia (New York, N.Y.) 2005 Mar;7(3):280-93
No comments: Submit comment
No validations: Submit validation data