Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502187 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the N terminal of human ALOX15B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPP
LPLDN LGKEFTAGAE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Loss of heterozygosity of 17p13, with possible involvement of ACADVL and ALOX15B, in the pathogenesis of adrenocortical tumors.
Soon PS, Libe R, Benn DE, Gill A, Shaw J, Sywak MS, Groussin L, Bertagna X, Gicquel C, Bertherat J, McDonald KL, Sidhu SB, Robinson BG
Annals of surgery 2008 Jan;247(1):157-64
Annals of surgery 2008 Jan;247(1):157-64
No comments: Submit comment
No validations: Submit validation data