H00026269-M04

FBXO8 antibody from Abnova Corporation
FBS, FBX8
No application information provided.

Antibody data

Product number
H00026269-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026269-M04, RRID:AB_1574836
Product name
FBXO8 monoclonal antibody (M04), clone 2F11
Provider product page
Abnova Corporation - H00026269-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FBXO8.
Antigen sequence
MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAA
SNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFIN
LEVLPPELSFTILSYLNATDLCLASCVWQDLANDE
LLWQGLCKSTWGHCSIYNKNPPLGFSFRKLYMQLD
EGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIF
CTRTLNWKKLRIYLDERRDVLDDLVTLHNFRNQFL
PNALREFFRHIHAPEERGEYLETLITKFSHRFCAC
NPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVK
NKMSKREFIRNTRRAAQNISEDFVGHLYDNIYLIG
HVAA
Isotype
IgG
Antibody clone number
2F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -