HPA002885

FBXO8 antibody from Sigma-Aldrich
FBS, FBX8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002885
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002885, RRID:AB_1078835
Product name
Anti-FBXO8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002885
Antibody type
Polyclonal
Antigen
F-box only protein 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISN
TNHRKQVQGGIDIYHLLKARKSKEQEGFINLEMLP
PELSFTILSYLNATDLCLASCVWQDLANDELLWQG
LCKSTWGHCSIYNKNPPLGFSFRKLYMQ
Storage
-20C
Provider Type Product Number
- No reagents -