Antibody data

Product number
ABIN182625
Provider
antibodies-online
Product name
anti-Homeobox A7 (HOXA7) antibody
Provider product page
antibodies-online - ABIN182625
Antibody type
Polyclonal
Antigen
The immunogen for anti-HOXA7 antibody: synthetic peptide directed towards the N terminal of human HOXA7
Reactivity
Human, Mouse, Bovine, Canine, Chicken/Avian, Rabbit
Host
Rabbit
Antigen sequence
MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNS
QRSGY GAGAGAFAST
Vial size
50 µg
Provider Type Product Number
- No reagents -