Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003363 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003363, RRID:AB_1078831
- Product name
- Anti-FBXO44
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLS
RDQRKEFPNDQVRSQARLRVQVPAVRSAPVVRARA
SGDLPARPGDHPAEERCQVEGGLPHILQLP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references FBXO44-Mediated Degradation of RGS2 Protein Uniquely Depends on a Cullin 4B/DDB1 Complex.
The F-box protein FBXO44 mediates BRCA1 ubiquitination and degradation.
Sjögren B, Swaney S, Neubig RR
PloS one 2015;10(5):e0123581
PloS one 2015;10(5):e0123581
The F-box protein FBXO44 mediates BRCA1 ubiquitination and degradation.
Lu Y, Li J, Cheng D, Parameswaran B, Zhang S, Jiang Z, Yew PR, Peng J, Ye Q, Hu Y
The Journal of biological chemistry 2012 Nov 30;287(49):41014-22
The Journal of biological chemistry 2012 Nov 30;287(49):41014-22
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human brain shows strong nuclear and cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong nuclear positivity in non-germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no nuclear positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
- Sample type
- HUMAN