HPA003363

FBXO44 antibody from Sigma-Aldrich
FBG3, FBX30, Fbx44, Fbxo6a, MGC14140
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003363
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003363, RRID:AB_1078831
Product name
Anti-FBXO44 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003363
Antibody type
Polyclonal
Antigen
F-box only protein 44 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLS
RDQRKEFPNDQVRSQARLRVQVPAVRSAPVVRARA
SGDLPARPGDHPAEERCQVEGGLPHILQLP
Storage
-20C
Provider Type Product Number
- No reagents -