Antibody data

Product number
ABIN405287
Provider
antibodies-online
Product name
anti-Homeobox A9 (HOXA9) antibody
Provider product page
antibodies-online - ABIN405287
Antibody type
Polyclonal
Antigen
The immunogen for anti-HOXA9 antibody: synthetic peptide directed towards the middle region of human HOXA9
Reactivity
Human, Mouse, Rat, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNR
RMKMK KINKDRAKDE
Vial size
50 µg
Provider Type Product Number
- No reagents -