Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405287 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Homeobox A9 (HOXA9) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HOXA9 antibody: synthetic peptide directed towards the middle region of human HOXA9
- Reactivity
- Human, Mouse, Rat, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNR
RMKMK KINKDRAKDE- Vial size
- 50 µg
Submitted references BRCA1 is a negative modulator of the PRC2 complex.
HoxA9 induces insulin-like growth factor-1 receptor expression in B-lineage acute lymphoblastic leukemia.
Wang L, Zeng X, Chen S, Ding L, Zhong J, Zhao JC, Wang L, Sarver A, Koller A, Zhi J, Ma Y, Yu J, Chen J, Huang H
The EMBO journal 2013 May 29;32(11):1584-97
The EMBO journal 2013 May 29;32(11):1584-97
HoxA9 induces insulin-like growth factor-1 receptor expression in B-lineage acute lymphoblastic leukemia.
Whelan JT, Ludwig DL, Bertrand FE
Leukemia 2008 Jun;22(6):1161-9
Leukemia 2008 Jun;22(6):1161-9
No comments: Submit comment
No validations: Submit validation data