HPA001669

SLC8A3 antibody from Sigma-Aldrich
NCX3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001669
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001669, RRID:AB_1857213
Product name
Anti-SLC8A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001669
Antibody type
Polyclonal
Antigen
Sodium/calcium exchanger 3 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEVDESRREMIRILKDLKQKHPEKDLDQLVEMANY
YALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQ
AKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENC
GAVLLTVVRKGGDMSKTMYVDYKTEDGSANAGADY
EFTEGTVVLK
Storage
-20C
Provider Type Product Number
- No reagents -