HPA002649

RPL27 antibody from Atlas Antibodies
L27
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002649
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002649, RRID:AB_1079840
Product name
Anti-RPL27
Provider product page
Atlas Antibodies - HPA002649
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHAL
VAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNY
NHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARR
EAKVKFEERYKTGKN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -