Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000242-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000242-A01, RRID:AB_463505
- Product name
- ALOX12B polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant ALOX12B.
- Antigen sequence
NPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFL
KTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIR
KIFPGKKSVVSEYVAEHWAED- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A role for 12R-lipoxygenase in MUC5AC expression by respiratory epithelial cells.
Hepoxilin A3 (HXA3) synthase deficiency is causative of a novel ichthyosis form.
Garcia-Verdugo I, BenMohamed F, Tattermusch S, Leduc D, Charpigny G, Chignard M, Ollero M, Touqui L
The European respiratory journal 2012 Sep;40(3):714-23
The European respiratory journal 2012 Sep;40(3):714-23
Hepoxilin A3 (HXA3) synthase deficiency is causative of a novel ichthyosis form.
Nigam S, Zafiriou MP, Deva R, Kerstin N, Geilen C, Ciccoli R, Sczepanski M, Lohse M
FEBS letters 2008 Jan 23;582(2):279-85
FEBS letters 2008 Jan 23;582(2):279-85
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ALOX12B polyclonal antibody (A01), Lot # 051130JC01 Western Blot analysis of ALOX12B expression in Jurkat ( Cat # L017V1 ).