H00000242-M01

ALOX12B antibody from Abnova Corporation
12R-LOX
No application information provided.

Antibody data

Product number
H00000242-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000242-M01, RRID:AB_1237641
Product name
ALOX12B monoclonal antibody (M01), clone 3G12
Provider product page
Abnova Corporation - H00000242-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ALOX12B.
Antigen sequence
NPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFL
KTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIR
KIFPGKKSVVSEYVAEHWAED
Isotype
IgG
Antibody clone number
3G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -