H00023462-M01
antibody from Abnova Corporation
Targeting: HEY1
bHLHb31, CHF-2, CHF2, HERP2, HESR-1, HESR1, HRT-1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023462-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023462-M01, RRID:AB_622328
- Product name
- HEY1 monoclonal antibody (M01), clone 3B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HEY1.
- Antigen sequence
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLV
SHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHI
AHPLLLPQNGHGNAGTTASPTEPHHQGRLG- Isotype
- IgG
- Antibody clone number
- 3B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hairy/enhancer-of-split related with YRPW motif protein 1 promotes osteosarcoma metastasis via matrix metallopeptidase 9 expression.
Tsuru A, Setoguchi T, Matsunoshita Y, Nagao-Kitamoto H, Nagano S, Yokouchi M, Maeda S, Ishidou Y, Yamamoto T, Komiya S
British journal of cancer 2015 Mar 31;112(7):1232-40
British journal of cancer 2015 Mar 31;112(7):1232-40
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HEY1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to HEY1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol