H00023462-M02
antibody from Abnova Corporation
Targeting: HEY1
bHLHb31, CHF-2, CHF2, HERP2, HESR-1, HESR1, HRT-1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023462-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023462-M02, RRID:AB_626434
- Product name
- HEY1 monoclonal antibody (M02), clone 2F10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HEY1.
- Antigen sequence
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLV
SHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHI
AHPLLLPQNGHGNAGTTASPTEPHHQGRLG- Isotype
- IgG
- Antibody clone number
- 2F10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Role of HERP and a HERP-related protein in HRD1-dependent protein degradation at the endoplasmic reticulum.
Huang CH, Chu YR, Ye Y, Chen X
The Journal of biological chemistry 2014 Feb 14;289(7):4444-54
The Journal of biological chemistry 2014 Feb 14;289(7):4444-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HEY1 expression in transfected 293T cell line by HEY1 monoclonal antibody (M02), clone 2F10.Lane 1: HEY1 transfected lysate(32.613 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HEY1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol