HPA063472

HEY1 antibody from Atlas Antibodies
bHLHb31, CHF-2, CHF2, HERP2, HESR-1, HESR1, HRT-1

Antibody data

Product number
HPA063472
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA063472, RRID:AB_2685018
Product name
Anti-HEY1
Provider product page
Atlas Antibodies - HPA063472
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSA
LGSMSPTTSSQILARKR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -