Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051692-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051692-M01, RRID:AB_606090
- Product name
- CPSF3 monoclonal antibody (M01), clone 6E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CPSF3.
- Antigen sequence
LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQ
DIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVE
CEEGSEDDESLREMVELAAQRLYEALTPVH- Isotype
- IgG
- Antibody clone number
- 6E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CPSF3 monoclonal antibody (M01), clone 6E6 Western Blot analysis of CPSF3 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CPSF3 expression in transfected 293T cell line by CPSF3 monoclonal antibody (M01), clone 6E6.Lane 1: CPSF3 transfected lysate(77.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CPSF3 monoclonal antibody (M01), clone 6E6. Western Blot analysis of CPSF3 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CPSF3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CPSF3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol