HPA002734

RPL11 antibody from Atlas Antibodies
L11, uL5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002734
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002734, RRID:AB_1079838
Product name
Anti-RPL11
Provider product page
Atlas Antibodies - HPA002734
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIA
VHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGN
FGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGF
SIADKKRRTGCIGAKHRISKEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -