HPA002734

RPL11 antibody from Sigma-Aldrich
L11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002734
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002734, RRID:AB_1079838
Product name
Anti-RPL11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002734
Antibody type
Polyclonal
Antigen
60S ribosomal protein L11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIA
VHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGN
FGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGF
SIADKKRRTGCIGAKHRISKEE
Storage
-20C
Provider Type Product Number
- No reagents -