Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107980 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Kruppel-Like Factor 9 (KLF9) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KLF9 antibody: synthetic peptide directed towards the N terminal of human KLF9
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
LRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDL
NKYRPIQTPSVCSDS- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Cell-specific translational control of transcription factor BTEB expression. The role of an upstream AUG in the 5'-untranslated region.
Imataka H, Nakayama K, Yasumoto K, Mizuno A, Fujii-Kuriyama Y, Hayami M
The Journal of biological chemistry 1994 Aug 12;269(32):20668-73
The Journal of biological chemistry 1994 Aug 12;269(32):20668-73
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Fetal Liver; Host: Rabbit. Target Name: KLF9. Sample Tissue: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml.; KLF9 Antibody - N-terminal region (AP42022PU-N) in Human Fetal Liver cells using Western Blot
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Jurkat; WB Suggested Anti-KLF9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat; KLF9 Antibody - N-terminal region (AP42022PU-N) in Human Jurkat cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Testis; Testis; KLF9 Antibody - N-terminal region (AP42022PU-N) in Human Testis cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human kidney; Rabbit Anti-KL9 Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; KLF9 Antibody - N-terminal region (AP42022PU-N) in Human kidney cells using Immunohistochemistry