HPA027202

MRPS28 antibody from Atlas Antibodies
HSPC007, MRP-S28, MRPS35
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027202
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027202, RRID:AB_1854126
Product name
Anti-MRPS28
Provider product page
Atlas Antibodies - HPA027202
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGS
ESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQ
KGSPKNVESFASMLRHSPLTQM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -