H00028957-B01

MRPS28 antibody from Abnova Corporation
HSPC007, MRP-S28, MRPS35

Antibody data

Product number
H00028957-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00028957-B01, RRID:AB_1138677
Product name
MRPS28 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00028957-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MRPS28 protein.
Antigen sequence
MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGS
ESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQ
KGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIF
HIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRV
RLRLLDLELTSRFLGATTDTTVLEANAVLLGIQES
KDSRSKEEHHEK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -