HPA027202

MRPS28 antibody from Sigma-Aldrich
HSPC007, MRP-S28, MRPS35
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027202
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027202, RRID:AB_1854126
Product name
Anti-MRPS28 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027202
Antibody type
Polyclonal
Antigen
28S ribosomal protein S28, mitochondrial recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGS
ESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQ
KGSPKNVESFASMLRHSPLTQM
Storage
-20C
Provider Type Product Number
- No reagents -