SAB1401652

MRPS28 antibody from Sigma-Aldrich
HSPC007, MRP-S28, MRPS35
No application information provided.

Antibody data

Product number
SAB1401652
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401652, RRID:AB_10609060
Product name
Anti-MRPS28 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401652
Antibody type
Polyclonal
Antigen
MRPS28 (NP_054737.1, 1 a.a. ~ 187 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGS
ESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQ
KGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIF
HIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRV
RLRLLDLELTSRFLGATTDTTVLEANAVLLGIQES
KDSRSKEEHHEK
Storage
-20C
Provider Type Product Number
- No reagents -