Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008048-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008048-M03, RRID:AB_565622
- Product name
- CSRP3 monoclonal antibody (M03), clone 6D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CSRP3.
- Antigen sequence
SPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYA
AEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDG
ELYCKVCYAKNFGPTGIGFGGLTQQVEKKE- Isotype
- IgG
- Antibody clone number
- 6D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CSRP3 expression in transfected 293T cell line by CSRP3 monoclonal antibody (M03), clone 6D2.Lane 1: CSRP3 transfected lysate(20.969 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CSRP3 monoclonal antibody (M03), clone 6D2. Western Blot analysis of CSRP3 expression in Hela S3 NE.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CSRP3 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol