Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182946 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cysteine and Glycine-Rich Protein 3 (CSRP3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CSRP3 antibody: synthetic peptide directed towards the middle region of human CSRP3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSK
FTAKF GESEKCPRCG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Early depression of Ankrd2 and Csrp3 mRNAs in the polyribosomal and whole tissue fractions in skeletal muscle with decreased voluntary running.
Mutations in the human muscle LIM protein gene in families with hypertrophic cardiomyopathy.
Roberts MD, Childs TE, Brown JD, Davis JW, Booth FW
Journal of applied physiology (Bethesda, Md. : 1985) 2012 Apr;112(8):1291-9
Journal of applied physiology (Bethesda, Md. : 1985) 2012 Apr;112(8):1291-9
Mutations in the human muscle LIM protein gene in families with hypertrophic cardiomyopathy.
Geier C, Perrot A, Ozcelik C, Binner P, Counsell D, Hoffmann K, Pilz B, Martiniak Y, Gehmlich K, van der Ven PF, Fürst DO, Vornwald A, von Hodenberg E, Nürnberg P, Scheffold T, Dietz R, Osterziel KJ
Circulation 2003 Mar 18;107(10):1390-5
Circulation 2003 Mar 18;107(10):1390-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
