Antibody data

Product number
H00006208-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006208-M05, RRID:AB_1137428
Product name
RPS14 monoclonal antibody (M05), clone 3G5
Provider product page
Abnova Corporation - H00006208-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RPS14.
Antigen sequence
TDLSGKETICRVTGGMKVKADRDESSPYAAMLAAQ
DVAQRCKELGITALHIKLRATGGNRTKTPGPGAQS
ALRALARSGMKIGRIEDVTPIPSDSTRRKG
Isotype
IgG
Antibody clone number
3G5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -